1. What information is available in the SaGP?

Soil salinization is a serious environmental problem in the world. Plants that are less tolerant of salt and alkali can also burden the environment. High-throughput sequencing data are accumulating rapidly in plant genomics, and there is an urgent need to annotate the function of these plant genes and explore the correlation with saline-alkali tolerance. Here, we developed a tool for predicting whether plant genes are associated with saline-alkali tolerance (SaGP), which aims to provide data on candidate genes for saline-alkali tolerance in plants. SaGP provides data related to plant saline-alkali tolerance genes and can predict whether the function of different plant genes is related to saline-alkali tolerance.

2. Database content and construction

Currently, 385 saline-alkali tolerance gene sequences from 133 plants from 91 genera and 1148 from Arabidopsis Thaliana have been included in SaGP. The saline-alkali tolerance data were all supported by experiments, and the saline-alkali intolerance data were all outside the saline-alkali tolerance genes.

3. How to use the SaGP?

  • Analysis

    • (1) Data preparation

      Get the protein sequence of the plant gene you need to predict and store it in FASTA format.

      >gene1

      MSSKAEPPAEVSLSVPPTPEGTPAPLISSRRVDSLSYERSSMPRCNCFPDGPTLTRKLVAEFVGTFILIFAATAGPIVNEKYNGAETLIGNAACAGLAVMIIILSTLVQLQEHEVEPPRPTRSFHR

      >gene2

      MGLPLMMERSSNNNNVELSRVAVSDTHGEDSPYFAGWKAYDENPYDESITYLEKKNPEGSMWGSKGAPGFRENALFQDYHGLKTFRQAMASFMEQIRTLLLFCWMNLGFLLEKKTKDGELQLWDVILKELNLNISPGSSCHCSEVGWFAEFMDRRRRF

    • (2) Data processing
      1. i. Paste your sequences (FASTA format)
      2. ii. Click "Start Prediction!"
      3. iii. View the results

  • Download

    You can download the positive and negative example data sets used by SaGP on the Download page.

4. Frequently Asked Questions

Q: Why "error" is shown for the result?

A: Check the format of uploaded data.

5. Development environment

SaGP is developed using

The SaGP database is freely available for the research community at https://. Users are not required to register or login to access the data in the database.

6. Updates

We are continuously curating and processing more omics data related to plant saline-alkali tolerance, and developing more predictive tools for plant resistance.